No Result
View All Result
Newsletter
Fancy Fashion Inc
  • Home
  • Fashion
    Aletta Spring 2026 Ready-to-Wear Collection

    Aletta Spring 2026 Ready-to-Wear Collection

    Tokyo James Spring 2026 Ready-to-Wear Collection

    Tokyo James Spring 2026 Ready-to-Wear Collection

    Armarium Spring 2026 Ready-to-Wear Collection

    Armarium Spring 2026 Ready-to-Wear Collection

    Best of The Best Celebrity Short Hairstyle We Love

    Prada’s Newest Sandals Are a Lesson in Elegant Comfort

    Instead of a Suitcase Just Put Everything in This Jacket

    Gynopedia Helps Travelers Find Health Care Everywhere

  • Beauty
    • All
    • Beauty
    • Celebrity
    • Fashion
    • Hair
    • Health & Fitness
    • Lifestyle
    • Makeup
    • Skin Care
    • Travel
    Nicola Brognano is appointed Creative Director at 7 For All Manking

    Nicola Brognano is appointed Creative Director at 7 For All Manking

    New York Fashion Week to Ban Fur on the Runway

    New York Fashion Week to Ban Fur on the Runway

    How Chanel’s Collection Design Has Changed Under Matthieu Blazy

    How Chanel’s Collection Design Has Changed Under Matthieu Blazy

    Meet the Models Who Made Their Runway Debuts at Chanel’s 2025 Métiers d’Art Show in New York City

    Meet the Models Who Made Their Runway Debuts at Chanel’s 2025 Métiers d’Art Show in New York City

    It Was a Starry (and Very New York) Front Row at the Chanel Métiers d’Art 2026 Show

    It Was a Starry (and Very New York) Front Row at the Chanel Métiers d’Art 2026 Show

    Chanel Pre-Fall 2026 Collection | Vogue

    Chanel Pre-Fall 2026 Collection | Vogue

    Trending Tags

    • Best Dressed
    • Oscars 2017
    • Golden Globes
    • Fashion Week
    • Red Carpet
    • D.I.Y. Fashion
    • Celebrity Style
  • Celebrity
  • Health & Fitness
  • Lifestyle
  • Travel
  • Home
  • Fashion
    Aletta Spring 2026 Ready-to-Wear Collection

    Aletta Spring 2026 Ready-to-Wear Collection

    Tokyo James Spring 2026 Ready-to-Wear Collection

    Tokyo James Spring 2026 Ready-to-Wear Collection

    Armarium Spring 2026 Ready-to-Wear Collection

    Armarium Spring 2026 Ready-to-Wear Collection

    Best of The Best Celebrity Short Hairstyle We Love

    Prada’s Newest Sandals Are a Lesson in Elegant Comfort

    Instead of a Suitcase Just Put Everything in This Jacket

    Gynopedia Helps Travelers Find Health Care Everywhere

  • Beauty
    • All
    • Beauty
    • Celebrity
    • Fashion
    • Hair
    • Health & Fitness
    • Lifestyle
    • Makeup
    • Skin Care
    • Travel
    Nicola Brognano is appointed Creative Director at 7 For All Manking

    Nicola Brognano is appointed Creative Director at 7 For All Manking

    New York Fashion Week to Ban Fur on the Runway

    New York Fashion Week to Ban Fur on the Runway

    How Chanel’s Collection Design Has Changed Under Matthieu Blazy

    How Chanel’s Collection Design Has Changed Under Matthieu Blazy

    Meet the Models Who Made Their Runway Debuts at Chanel’s 2025 Métiers d’Art Show in New York City

    Meet the Models Who Made Their Runway Debuts at Chanel’s 2025 Métiers d’Art Show in New York City

    It Was a Starry (and Very New York) Front Row at the Chanel Métiers d’Art 2026 Show

    It Was a Starry (and Very New York) Front Row at the Chanel Métiers d’Art 2026 Show

    Chanel Pre-Fall 2026 Collection | Vogue

    Chanel Pre-Fall 2026 Collection | Vogue

    Trending Tags

    • Best Dressed
    • Oscars 2017
    • Golden Globes
    • Fashion Week
    • Red Carpet
    • D.I.Y. Fashion
    • Celebrity Style
  • Celebrity
  • Health & Fitness
  • Lifestyle
  • Travel
No Result
View All Result
Fancy Fashion Inc

Dion Lee Is Back, Just Not How You Expected

admin by admin
2025-11-20
in Hair
0
Home Beauty Hair
Share on FacebookShare on Twitter

In May of 2024, Dion Lee made headlines when his eponymous label was placed in voluntary administration in his native Australia by Cue Clothing Company, which owned 70% of the business.The news came as a shock for industry watchers, particularly stateside where Lee had built a robust customer base. In addition to his stores in Australia, Lee had opened a retail destination in Miami in 2023 and was readying a New York flagship. He had shown his fall 2024 collection—what would turn out to be his last for the brand—in Shanghai a month prior to the news. From the outside looking in, everything seemed to be running smoothly. It wasn’t. But now, a year and a half later, Lee is back with a new project.

Today, Lee is launching Haelo (stylized HÆLO), a new label under his creative direction. In the time between the effective dissolution of his eponymous line and today’s launch, Lee relocated from New York to Paris, saw the Dion Lee brand scooped up by Revolve (a backer and the exclusive retail partner for this new venture, together with Fwrd), and turned 40. Until recently, he’s remained mostly mum about the breakdown of the business he had built over the course of 15 years, first in Australia and subsequently in New York.

Image may contain Karmen Pedaru Adult Person Blouse Clothing Skin Tattoo Face and Head

Photo: Hart Lëshkina / Courtesy of Haelo

Image may contain Adult Person Accessories Photography Face Head Portrait and Headband

Photo: Hart Lëshkina / Courtesy of Haelo

Image may contain Mona Johannesson Bra Clothing Lingerie Underwear Adult Person Face Head Photography and Portrait

Photo: Hart Lëshkina / Courtesy of Haelo

Image may contain Sandra Vergara Adult Person Body Part Finger Hand Dancing Leisure Activities Face and Head

Photo: Hart Lëshkina / Courtesy of Haelo

“Without going too deep into the business black hole,” Lee says with a laugh, calling from Los Angeles where the new brand is based (Lee splits his time between Southern California and France), “Haelo started with the opportunity to create a new brand,” he says. “Having only designed for myself, I was really excited by the opportunity.” The designer says that it felt refreshing to conceptualize a new label from the start, building out “the look and feel from the identity and the product to the communications, and to do that from a new perspective.”

The idea of building something new that wasn’t attached to his name and personal identity held appeal. “It was a nice departure from my previous experience,” he says, “having had so much of my personal identity ingrained in what I was doing.” This was followed by a concession: “There is obviously an element of design handwriting that is so built into everything that you do. Even though we sometimes try to distance ourselves from that, it’s pretty consistent in terms of how I like to do things, how clean things are.” Meaning, the neat, sharp language that had become Lee’s signature remains, only here it’s offset by a little more softness. “It was definitely an exercise of trying to push myself out of that comfort zone, but then knowing that it makes sense to come back to a certain place at the same time.”

Image may contain Mona Johannesson Clothing Coat Jacket Adult Person and Leather Jacket

Photo: Hart Lëshkina / Courtesy of Haelo

Image may contain Adult Person Clothing Underwear Lingerie Sitting and Beachwear

Photo: Hart Lëshkina / Courtesy of Haelo

Image may contain Clothing Footwear Shoe High Heel Adult and Person

Photo: Hart Lëshkina / Courtesy of Haelo

Image may contain Arm Body Part Person and Adult

Photo: Hart Lëshkina / Courtesy of Haelo

Playing on the idea of a halo, the brand’s aesthetic angelic references with almost gothic ones. There’s also “this idea of afterlife,” he says, “an afterlife of my own brand, that was fun to play with—this motif of coming back to life and resurrection.”

Though recognizably Dion Lee with its cutouts and strategically placed sheer panels, slits, and such, this first iteration of Haelo does venture into softer fabrications like draped silks and lace elements. “I definitely tried to push things, but I think the other part of that conversation was also me thinking about what does Dion Lee look like in the future?”

Image may contain Karmen Pedaru Accessories Glasses Face Head Person Photography Portrait Earring and Jewelry

Photo: Hart Lëshkina / Courtesy of Haelo

Image may contain Adult Person Face and Head

Photo: Hart Lëshkina / Courtesy of Haelo

Image may contain Adult Person Clothing Glove Fashion Coat Face Head Photography and Portrait

Photo: Hart Lëshkina / Courtesy of Haelo

#Dion #Lee #Expected

Tags: DionExpectedLeerunwaysplitscreenimageleftinsetstorytype:news & trendingweb
Previous Post

Bra Tops in Autumn? Celebrities Are Daring to Bare

Next Post

A Power Lunch for the Ages Celebrating CityMeals on Wheels

admin

admin

Next Post
A Power Lunch for the Ages Celebrating CityMeals on Wheels

A Power Lunch for the Ages Celebrating CityMeals on Wheels

Leave a Reply Cancel reply

Your email address will not be published. Required fields are marked *

Search

No Result
View All Result

About Me

Fancy Fashion Inc

Mocha Rose

Fashion Blogger & Traveler

Hi & welcome to fancy fashion inc blog! A independent blogger with a passion for sharing about fashion and lifestyle.

Facebook

Categories

  • Beauty
  • Celebrity
  • Fashion
  • Hair
  • Health & Fitness
  • Lifestyle
  • Makeup
  • Skin Care
  • Travel
  • Home
  • Fashion
  • Beauty
  • Celebrity
  • Health & Fitness
  • Lifestyle
  • Travel
Email: admin#fancyfashioninc.com

© 2025 Fancy Fashion Inc - Premium Fashion Blog.

No Result
View All Result
  • Home
  • Fashion
  • Beauty
  • Celebrity
  • Health & Fitness
  • Lifestyle
  • Travel

© 2025 Fancy Fashion Inc - Premium Fashion Blog.